DPCstruct | MC17643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2TPP3 | 2-88 | AYFGNKNSSVAVCTLSSIDLLKKLSEPKFLQNVAMIGRLLSENKGIESLVHYVNKNPNIKTIILCGKEVWGHKAGHSLLQLHKNGVD |
| A0A256XJJ0 | 1-95 | MDYNIFSVVTKDIVFINKKSNIAIATLWTKKESIIQKLKNKNKVNVAGTLYSTYGINYLLHTLASNPQIDTIILFGADLSGVGDVLK… |
| A0A7T9DLG5 | 1-93 | None |
| A0A0F9HT24 | 1-78 | None |
| A0A533UWB3 | 16-108 | None |
| A0A0G1QSR7 | 5-117 | None |
| A0A497TKQ3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.