DPCstruct | MC17637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 30 aa |
| Standard deviation of domain lengths | 29.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MTB0 | 28-137 | VMEELDKQYQDDRALIKDEVKSGKIPMLASWTLEDFQAAVTEDEKYKGVSNINIKLIYEDQIERLKEKDLKEAKKRQRLGDNFLDLL… |
| A0A2G2YHX1 | 4-123 | VVACIVLQYLDDKSQIKDAVRMAEIGLTSTWTLDDFKVAIAKYISSPPMSDTNLKFAFEELLERAREKEEKESKKRKRLADEFYELL… |
| A0A2G3AT00 | 460-583 | None |
| A0A2G3B577 | 562-661 | None |
| A0A2G3B5B1 | 1-105 | None |
| A0A183Q3Q6 | 15-143 | None |
| A0A811VC32 | 11-174 | None |
| A0A178VDJ1 | 176-277 | None |
| A0A1U8EW80 | 4-99 | None |
| A0A0S7F8U1 | 219-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.