DPCstruct | MC17635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19160 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4U4G0 | 180-275 | SCPVVDANKFESIVDSSKILTACGKVDPVKECCQQVCQNAILDAARKIAMDGMVSMPENSTRIDDCKSIVFRWLASKLDPSSANGVL… |
| A0A251UKA2 | 1-104 | MLTDTSKILASCGKIDLVNECCRETCQNAISEAAKDLASVSNEFDAMGIRRMSDISTRVINDCKSIVLRWLASKLEPLRAKEALRGL… |
| A0A6A3CV68 | 141-245 | None |
| A0A287FHG3 | 184-338 | None |
| A0A446MA38 | 173-284 | None |
| A0A5B6W9S2 | 91-231 | None |
| A0A2N9I6Y3 | 148-249 | None |
| A0A251T6U3 | 149-260 | None |
| A0A5B7ABC9 | 84-210 | None |
| A0A4D9BK61 | 157-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.