DPCstruct | MC17633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835J0F6 | 2-85 | SAILGFFASACRLPFDYVKSQIQKTQPNATGKYSYRGSLDCVLKTWKAGGALKFYTEFPVYCVKIAHYVKDFFMIFSFLKNSFR |
| A0A813A114 | 34-120 | AAFAGGFFGSVFSLPFDFVKTQLQKMKPDPSTGEMPFKGPLDCALKTLRASPLRFYSGFPVYFARTGPISTITLIVQDRIKKLWAAL |
| A0A396GNA7 | 2-63 | None |
| A0A7J7N6J7 | 121-210 | None |
| A0A7J7MXC5 | 3-91 | None |
| A0A7J7L2P0 | 203-288 | None |
| A0A835HQG9 | 92-190 | None |
| A0A835HZY3 | 136-194 | None |
| A0A7J6RDZ0 | 182-263 | None |
| G7LIQ7 | 63-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.