DPCstruct | MC17632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 180 ± 37 aa |
| Standard deviation of domain lengths | 36.67 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5E693 | 206-469 | GNGSFNNVHLALLIFFTPAVLLRLLPFVKARWFGWTSYMVLVALCGVPVAILYWTAMSMYGARINEKVTLPNRPLEYYLDIKDEALR… |
| A0A2G2Y2N9 | 95-283 | KRTYSVLNNPKHMVPTWPETEARLLVTRFLKSFIATGCIILLEEWGTMFTFEGTEKKCSLKVYLRVHSPQFHWKVETQGDLGIADAF… |
| A0A6C0K2Y8 | 41-241 | None |
| A8J219 | 472-667 | None |
| A0A1F8ESN1 | 8-167 | None |
| I3T8U0 | 3-141 | None |
| A0A5B6W0B7 | 109-252 | None |
| M1W108 | 306-470 | None |
| A0A6J7HW77 | 276-502 | None |
| A0A1R3L4G4 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.