DPCstruct | MC17631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 188 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4I1Q6 | 11-185 | IVLLLNIAAVFVGIWFYSGQLASSSPLLWIFIPDCPLYIFLCTLILIGKIKSDLLRLLISANTLKYGLWTMLVLFFYGNYYFSSADI… |
| A0A6G1Z1S1 | 13-213 | DEWVEYYLGNGPSLVVFILLNASAFLVGVSFYVHSDPSLADIPTFLYPLFGDSPTALALMTLSAATLLPNLGRRVVDAPVNRPLAYL… |
| A0A7V7BBK6 | 2-161 | None |
| A0A2P6VVL4 | 88-296 | None |
| A0A1H0FC74 | 2-190 | None |
| A0A2R6CK27 | 25-241 | None |
| A0A3A0ABR2 | 86-276 | None |
| A0A2M9NDD2 | 5-166 | None |
| A0A1F4XKC5 | 15-210 | None |
| A0A2H9NAR3 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.