DPCstruct | MC1763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 198 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1M0W5 | 2-160 | LVIIARKQTRIGELLREKFVFQLVIRQRNQNILNLQGQILALQNNPLGNMADARRLPVLTMIAPVLAKTKPYIGQEPPDDYLDRLIQ… |
| A0A2P4QJ16 | 42-241 | VFNATTQNLDEIIRQAALMQEIGVDQLNQIEGLQTLLGESLDRTNTLNQDLIRVCDDFTYERNACRHWETIAQQNQARASTGPEYFN… |
| A0A397UEC1 | 249-454 | None |
| U9T2I5 | 16-269 | None |
| A0A397J3P2 | 3-181 | None |
| A0A397J103 | 152-360 | None |
| A0A397I956 | 46-235 | None |
| A0A397S6G1 | 192-381 | None |
| A0A397U5G5 | 123-311 | None |
| A0A2Z6QEP6 | 43-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.