DPCstruct | MC17628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 184 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5FX06 | 20-195 | DESIHSTLLRTLLAHDPNIKPIGVISDFGRWIDNPFVHKGYEHLFYRNPDHLLLETIDMNLSVNGKGNSLFDNPAVYTYRIESTFFS… |
| A0A0H2XKB9 | 1-190 | MVYENELWHSFLLRSQIMYNLSNCRNIISKHGALRYDAFPRFELIDMYKLHSLQDIYDILATRNGYILTSNIVSLSSGVYGYFNAVE… |
| A0A2T3HVS4 | 2-195 | None |
| A0A086WNN0 | 18-201 | None |
| A0A481QJ66 | 1-156 | None |
| A0A5P9F0Z8 | 37-220 | None |
| A0A6G3L6Z6 | 5-207 | None |
| A0A0B8PZG8 | 2-202 | None |
| A0A7Y8YBQ8 | 1-172 | None |
| A0A7W4GID0 | 6-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.