DPCstruct | MC17627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 367 ± 60 aa |
| Standard deviation of domain lengths | 59.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S8E7I2 | 6-336 | SLSASSQRERSSTSWADLDLSIIVACVSPIGNWLTGGDHIKNLLLIILLIFYLHQLIEVPWRLYQASRPRKSPGSRTGEPDRVTKLA… |
| A0A2J8FAZ6 | 40-479 | IRRANTIDESYRRPRSSVTSAAATASGPYDVPRRRDSTLSDYSLGDAGGLFNPKPLGHKPSAEDGSKWTHLPIAFALLPAVGGILFQ… |
| A0A2S5B719 | 159-489 | None |
| A0A6A6PXW9 | 1-459 | None |
| A0A135LLZ6 | 478-789 | None |
| A0A0C9X9A9 | 92-468 | None |
| R4X8W2 | 33-330 | None |
| A0A1D8NKP6 | 29-443 | None |
| A0A0N0RT15 | 52-495 | None |
| A0A3N4L3E3 | 6-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.