DPCstruct | MC17622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 204 ± 23 aa |
| Standard deviation of domain lengths | 23.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AJB5 | 175-372 | IGNLPARSCCTGDSDSAKAILSVYEGLQAEGIKPYDAYTNSKMEPITLYEVIGEGSLKMFVLNPERGSKDLVGLANSIKSGDEGVEQ… |
| A0A0S7FJE9 | 147-333 | FVNFPENLENPEPDYKVCRNVEEAAFTQVFLNKLNLRIEPLQKPVGNAIEPITLFQKMGVGRLEMYVLNPSKNSKEMQHFMKQWTGS… |
| A0A7J7Y0P4 | 358-522 | None |
| A0A4W3HRX7 | 141-370 | None |
| A0A4S2MJJ1 | 332-557 | None |
| A0A7M3RMC7 | 277-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.