DPCstruct | MC17619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 241 ± 40 aa |
| Standard deviation of domain lengths | 39.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168M7J5 | 36-218 | WETVEEDMKLPTQASNTMVRSLFYVCEEIQRINSSIVDQTIMTRLRQQLANAVNHVFQASLPTLELTENGTLQLMFDYLFMCTVLQQ… |
| A0A3P7N375 | 18-214 | VEVPVQISRILYGFLYDLCQKISDNSVGHLCTRNIQSHISQQLSELLASVYSAVAHSDMEWSSRIALQYLFDARFLNIILPNGAMRP… |
| A0A7J6VSP9 | 1-258 | None |
| A0A7S0QQQ3 | 4-207 | None |
| A0A314YAX5 | 4-334 | None |
| A0A7S4KJP1 | 55-365 | None |
| A0A2J7Q189 | 3-213 | None |
| A0A6V7XPW8 | 554-818 | None |
| A0A2H5SD68 | 324-571 | None |
| T1PJS1 | 158-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.