DPCstruct | MC17613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 37.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6SDA3 | 9-147 | KYHNFHASVFQVKALENDIEDLHGEFELDRLDYLETIRKQDQQIKLLQQIVDKIHPVLKKDCNYFNIEKIKREATWNEDQGKWTLPD… |
| A0A556V975 | 165-312 | ANARKKQLIEALSKCSDDGDAVLLNVYDSIQEEVHAKNRILENAQSKLKAAKLEIRDLQVEFAAERDDYLASIRRLERETQLLLGLL… |
| A0A177B7J0 | 271-412 | None |
| A0A183WF75 | 1-156 | None |
| A0A2H2J7V0 | 26-163 | None |
| A2AM74 | 621-752 | None |
| A0A1Y1KQN8 | 15-157 | None |
| A0A6A4WZK6 | 715-843 | None |
| A0A4W5PS26 | 85-199 | None |
| A0A2G8KAJ6 | 140-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.