DPCstruct | MC17611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 89.78 |
| Assigned Pfam label(s) | CL0167- PF04674- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226NWM5 | 382-461 | SLLGAGKKRKKKTYTKPKKQKHKKKKVKLAVLKFYKVDANDKVTRLRKECPRETCGAGVFMAAHENRTYCGRCGLTYILN |
| A0A3P6RIP7 | 4-80 | GGKKRKKKVYTTPKKTKHKRKKVKLAVLKYYKVDENGKISRLRKECSSPTCGGGVFMASHQNRYYCGKCYQTLVMQD |
| Q7DLL9 | 2-54 | None |
| A0A842UWJ2 | 5-71 | None |
| A0A850M0M3 | 1-52 | None |
| A0A1J1IF37 | 38-89 | None |
| A0A5N6NSK9 | 39-129 | None |
| A0A7R9CLT2 | 1-77 | None |
| A0A822IFJ5 | 1-73 | None |
| A0A519BUC0 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.