DPCstruct | MC17610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8WHB1 | 9-110 | QVTQVIGYHPRYRDHFLRTQNFIMKGDGPLPYAYRYYLAIIAAARHQCPYLVKRYEKEFLNQGGNREWLNGVDYIPAKLRAIYDINK… |
| A0A3P6RCS1 | 1-104 | MSLHPKYRTVFCQTIDQLFYGRGPLAICERHYIALMAASRHRCHFLMDLHTREFERTGGKREWLKGLVNAPKKIQNLDALSTVLAHQ… |
| A0A183PGR8 | 162-291 | None |
| Q4S6X1 | 161-276 | None |
| A0A182FGE2 | 53-154 | None |
| A0A7J8KGK6 | 3-119 | None |
| A0A3M0JBR2 | 298-405 | None |
| X6NR86 | 277-377 | None |
| A0A2J8L1I2 | 79-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.