DPCstruct | MC1761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 252 ± 37 aa |
| Standard deviation of domain lengths | 37.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4QDZ0 | 2-267 | DTVSTLFQKVTTDEYKKSTELTGNLIKWDVRVEGGKINLAVSTVNKHNTEGESISTRTENYPYKAKYSFYKHGLIASSLFNNNDIVI… |
| A0A2Z6R0Q4 | 15-251 | APSNEKKIILKDKVEVEDSDLHEFVLRPNDTYDEISLERNDICKKTSSFSHILSYKLLNNQYLILISMEAIEIYTLNKNFINRYFWN… |
| A0A397V7D3 | 279-591 | None |
| A0A397VDD1 | 365-534 | None |
| A0A397TPY4 | 143-395 | None |
| A0A397U5V1 | 394-664 | None |
| A0A397UET2 | 93-354 | None |
| A0A397UHK1 | 177-443 | None |
| A0A2N0R1R3 | 136-341 | None |
| A0A397SNB5 | 278-507 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.