DPCstruct | MC17604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 11.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4E243 | 150-240 | HGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGVHYITWRRQNKVFPQDKGHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHV… |
| A0A183EYU8 | 4-90 | FRYNCGDESCYLDLARLRGVKYFTWAKNDKVIAVGENLQRAGQSHKKFQNYRFDGAEFRRLVLLQIEYVRRHPAYVAEVRKRRRKQF |
| A0A4Y7LPB0 | 401-481 | None |
| A0A7R9KCL1 | 1011-1115 | None |
| A0A6S7GCS3 | 277-354 | None |
| A0A7J7WCF4 | 357-436 | None |
| A0A2I0T6N9 | 112-188 | None |
| A0A2B4RW15 | 576-663 | None |
| A0A4Y2X0K3 | 11-93 | None |
| A0A368FAY8 | 9-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.