DPCstruct | MC17602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 49.76 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | CL0329- PF03725 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MZ64 | 34-108 | KVWQIRVDVHMLNHDGNLMDAASIAAITALCHFKRPDVGIQGDEVTVYSPEERDPIPLSVYHMPISVSFSFFQQG |
| A0A183EXJ7 | 1-64 | LDEDGSLVDCACIASLTALAHFRRPDVSVFSDSIVIHSGSDKIPIPLNIYHMPVCVSFGMFADG |
| A0A498N956 | 210-272 | None |
| A0A6A6KUY5 | 105-168 | None |
| A0A4Q2D123 | 37-110 | None |
| A0A834FQG1 | 84-144 | None |
| A0A5B7E3A8 | 80-147 | None |
| A0A453NG27 | 139-207 | None |
| A0A816ATD8 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.