DPCstruct | MC17601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819FEZ9 | 44-175 | LSPPLSQMTVNDICDCLKNDVIGLKPTMIPIYIQDINENNISGRVLITCELDELKQILSMTFGDWVLFSNWVRTKREEEQRSRFHLQ… |
| A0A433U089 | 303-416 | ASMELSQMSVSDVCDLLADLKGLSSSLLTTYQSRVRDNNISGLVLTMCDLTDLRPVLDMKFGDWQLFRSAVSSLLEHGLCGESDDKD… |
| A0A4Z2BQE3 | 658-785 | None |
| A0A6I9N5T5 | 1-103 | None |
| A0A821R1I8 | 241-364 | None |
| A0A7M3VKD1 | 1-109 | None |
| A0A819RPZ2 | 464-604 | None |
| A0A667ZI94 | 458-574 | None |
| A0A6A4XCE3 | 30-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.