DPCstruct | MC176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 360 ± 32 aa |
| Standard deviation of domain lengths | 31.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0CF73 | 4-361 | IDFCNKVVTIPQSGGTCWFTAILMSLLYSQHSRKLLYNHLEQFKDKDDLLKILNTILKYHYVNPEKAESFFSKYTSENILDYVQILD… |
| A0A6C0BFW8 | 3-339 | CNKVITIPQYTGTCWFNAILMTVFFSQYMRNVLMTKESNWKMPLKTRKLFRDILKRRYTVFEMKQQAYMFFQVITPEYILKQLHKER… |
| A0A6C0LNR8 | 291-696 | None |
| A0A6C0LKE5 | 9-366 | None |
| A0A6C0LJV2 | 1-292 | None |
| A0A6C0LI02 | 2-376 | None |
| A0A6C0LJ90 | 2-345 | None |
| A0A6C0LBS2 | 271-629 | None |
| A0A6C0K846 | 9-370 | None |
| A0A6C0LFF5 | 14-422 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.