DPCstruct | MC17590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 249 ± 34 aa |
| Standard deviation of domain lengths | 34.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 88.10 |
| Assigned Pfam label(s) | PF00557- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7E4X5 | 9-264 | DQDEAVFGTGIEFRESALLIGPKNTTVAKKGQVFNVNLGFSDLINPDASGSSKKYALFIGDTVVVNEEQAATILTATSKKKLRNVGV… |
| A0A183EPW3 | 1-236 | MYYLSCRFLTGLEFRESAALISPKCEIEIRPNMVFIVCVGLHGLVNPEAKDEQSKTSAVLLSDTVLISAEGANEILTEKAKSRLKSN… |
| A0A7S0QUN9 | 323-636 | None |
| A0A2C5XPT4 | 37-298 | None |
| U9U0Z2 | 30-245 | None |
| A0A2I3H210 | 1-224 | None |
| A0A7J6T665 | 14-226 | None |
| A0A7S3EIK3 | 91-349 | None |
| A0A453AH07 | 23-274 | None |
| A0A453AGZ3 | 325-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.