DPCstruct | MC17585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7PKZ9 | 86-181 | PQKVPFGVDPKSILCQYFKQGFCDKGKKCKFSHNLDVEKRSEKKDIYTDSRLIHLNENKSLIDKKNDTIDLWDDEKLQSVVLSKHGN… |
| A0A183ENQ7 | 1-98 | MPKVARDVDPKSVVCLFFKQGMCHKGEKCKFSHDLSKEQKTAKKNLYVDSRDLANENGHFSLLPDNMDDWDESKLNEVAEKKHGEQD… |
| A0A232FC98 | 273-362 | None |
| A0A5N5SSY1 | 31-109 | None |
| A0A0K2VDD7 | 91-176 | None |
| A0A3P6FZC3 | 80-165 | None |
| A0A162QNH6 | 62-143 | None |
| A0A183M3A1 | 68-174 | None |
| A0A2I0HL54 | 80-164 | None |
| A0A820K4Z2 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.