DPCstruct | MC17583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4AIK1 | 219-310 | SNDTEFYSYVEFPLGCTKDGVEYRLVQAAYKQKPGRRLAQALGLSEDDDILFVVFSQGQKNRSNPPRETVLCLFTLHDINLAMRDRI… |
| A0A183EME3 | 2-110 | LVAFRAADSRDAHFWSYTEVPLECLHGSEMYNLVQDVYLSKPGYDLALSLGVSVEDDVLYGVFVKGWDVEETIPSSQSALCVYSMAT… |
| A0A6P4L977 | 314-421 | None |
| A0A060XHB9 | 73-180 | None |
| A0A3B5A870 | 181-274 | None |
| A0A3Q3WXD9 | 275-379 | None |
| A0A158R380 | 194-299 | None |
| A0A443SVY2 | 285-389 | None |
| K7I5J3 | 1-126 | None |
| A0A0N4U5E3 | 281-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.