DPCstruct | MC17582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A2VDX3 | 5-100 | NIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFSHLKEVLNNVTELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNK… |
| A0A183EM46 | 1-101 | MAVNGFYVVQGEANAVVALLKKAHRGAWPHQQQHVQLGHSLLDETDPLLRNFADLRDVFSSVNDLTDMNPNTFLSPFLDVIRSDQTN… |
| A0A3Q0J0I0 | 3-106 | None |
| A0A7R9FV00 | 8-104 | None |
| A0A183UI76 | 185-296 | None |
| A0A0B2V902 | 216-303 | None |
| A0A6J1WN17 | 2-100 | None |
| A1Z8W8 | 7-101 | None |
| A0A5E4QZ39 | 2-103 | None |
| A0A077Z157 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.