DPCstruct | MC1758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 150 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015JYM4 | 98-254 | NAIDLIMNISQRICLPEQKKEDTRKDLLYNNIIKLFRSKMVGWRNGIQNTFGKSFVECLTAALWYIDPHRTKFTERSLLLGELFNEL… |
| A0A2P4Q5N5 | 3-152 | RAHQPYFPMQKREDTQRDTLYNDVISLLRKNQKYGWSGVNSESIAKKFVDRLVALLWYIDPHWEKLISRSLKLPDIFNELEQYQCNE… |
| A0A2H5SSF6 | 585-713 | None |
| A0A2I1EXI5 | 5-156 | None |
| A0A2I1F677 | 1-130 | None |
| A0A2Z6RAW7 | 87-258 | None |
| A0A2Z6RQQ3 | 3-146 | None |
| A0A2W0BKV8 | 87-257 | None |
| A0A015LKK2 | 17-160 | None |
| A0A2I1H422 | 98-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.