DPCstruct | MC17579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 251 ± 39 aa |
| Standard deviation of domain lengths | 39.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.68 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF01267- PF06732 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8XRX5 | 202-460 | MAKIKKKGTSGQAKNYITRTQAVRKLQISLPDFRRLCIFKGIYPREPRSKKKASKTSTPNTTFYYTKDIQYLLHEPLLRKFRDQKAL… |
| A0A183EKN5 | 2-226 | KKLQLPLKDFRRLCIFKGIYPHEPLHKKKMYDGILFSKCCHLSYIFQVFLRKLATAKGKREEDRVKKLYERRPEYQLDNIVKERYPT… |
| A9BK35 | 1-229 | None |
| A0A139H693 | 453-712 | None |
| A0A5Q3CYN9 | 1-284 | None |
| V6TEQ9 | 6-211 | None |
| A0A044V441 | 4-280 | None |
| A0A2P8XXZ6 | 24-235 | None |
| A0A7R8ZZI0 | 68-318 | None |
| A0A1I8FQ89 | 247-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.