DPCstruct | MC17578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7MLQ0 | 9-143 | RSIWTWGYQQNEPTNSERQKHAVELSRKIGIEIIPPKIPLAEELILRPSRIKIPDNLSSYCFTDNYERALHSYGAERELAALGEFPN… |
| A0A183EK27 | 28-192 | DHILKWNGWGYADSYFEAINPQELAFTGDRYEISGRRLPFLKQYMCETLGIDVDYRTPSVLYEEVSVPTSVDNQQFIDFLLEKGISF… |
| A0A7S1ZTA0 | 444-649 | None |
| D2VLW2 | 10-154 | None |
| A0A7I7LAT5 | 1-110 | None |
| A0A7P0TA54 | 79-241 | None |
| K7HD66 | 10-161 | None |
| A0A4W3JEM4 | 12-163 | None |
| A0A811KCX9 | 9-144 | None |
| A0A1I7XJI2 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.