DPCstruct | MC17574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 53.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811Q110 | 1-126 | MTKAEKVDAVLRRLSNPPKCHCGVLTRLTTHSQCGAFTAFYRCGLPDYRGFSSCDFEEYNYGPKSYWPSEYEFAEFQAGIKPWPRTK… |
| A0A835C5I4 | 71-240 | FFQWIDGPEKFDPRIRLFPYESHKLVPYHEFRRWVAPPPNPPPMTVDERMATARRRRKDPPLCHCGVRATLVVPPRGGSPSGRLKYS… |
| A0A811NIT0 | 103-241 | None |
| A0A0D9VGU7 | 2-123 | None |
| K3XQB9 | 203-339 | None |
| A0A835KRV7 | 6-144 | None |
| A0A835K8T2 | 1-115 | None |
| A0A835EYV8 | 40-162 | None |
| K3YC87 | 1-104 | None |
| K4A2E8 | 104-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.