DPCstruct | MC17573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 215 ± 40 aa |
| Standard deviation of domain lengths | 39.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8NUM3 | 3-170 | VALFTFSPADPSWSQTAWGGEVQNAGGLFGAWIADTLLFTFGVLAYALPPALILLTWTTFRKRMPDESIDLMLWGTRLLGGALLIVT… |
| A0A1H6RWD1 | 6-202 | PLLAALALFACATYVLTALLSFSAQDPGWTHVNEFTQVENWLGMTGAWLADVLLSVLGYGAYMGVFLLIWWGIWLALMPMRHTDFDP… |
| A0A0M3C467 | 2-255 | None |
| A0A2X2LE41 | 14-267 | None |
| A0A1N7JGF0 | 305-528 | None |
| A0A257LSL1 | 29-235 | None |
| A0A1Q3YU52 | 24-247 | None |
| A0A7C2XYG9 | 17-226 | None |
| A0A0G1AHC7 | 1-191 | None |
| A0A416Q169 | 73-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.