DPCstruct | MC17572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2UKJ8 | 23-111 | GERSNIDFAMHARAMGADAVHVKDVAELKAAMVKARQAKRTQVIVIDTTHTRTTDGGCWWEVAIPEVSTRAEVREAHANYLKGQAQQ… |
| A0A3M5X179 | 1-86 | MDFAMSAAAYGCKTYKVSTAEQLRQALADAQRQTVSTLIDIKVLPKTMIHKYLSWWRVGVAEVSTTGTTAQVYEKLNRELLKARQY |
| A0A7W0N9A3 | 1-104 | None |
| A0A838JXI6 | 1-72 | None |
| A0A838G319 | 7-105 | None |
| A0A6N7YN06 | 74-177 | None |
| A0A3D1HP58 | 1-86 | None |
| A0A6J6ZSQ0 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.