DPCstruct | MC17569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 109 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5ZDF4 | 1-83 | MYKQCGYCVTSDGKTIVCYHPTVDVPYELTQILKAHLSKEVLRDKKGPTIEELSKMFFTTKHRWYPVGQYHQRRRKKDPPKDR |
| A0A2H1X136 | 1-113 | MAHIIRAIAFKPRDILTRSYNKIVITDDGSTIVALHKDQEFPYEFSRPLPTETVADKSILRMNDTQEVYRVFRDLKPEIARKQLSSL… |
| A0A667FY53 | 13-139 | None |
| A0A0U2UTI7 | 18-146 | None |
| A0A812DXV6 | 23-139 | None |
| A0A803JZR2 | 14-101 | None |
| A0A7R9FQY8 | 3-115 | None |
| A0A4W2EK33 | 71-190 | None |
| A0A7I8VHV0 | 8-99 | None |
| A0A0B2UWN2 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.