DPCstruct | MC17568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1WVT4 | 1-61 | MLKEAASLIMKHTVTTRRHLTPELVLRLITPECPLWRATEEQIPFKDPFWAFYWPGGQATA |
| A0A0N4YHX7 | 125-189 | RRTAKWILRNTILTDQSLTPELRLHLITKESSLWKARPEDCPFPDPYWAFYWPGGQAVTRYILDN |
| H9JWN9 | 1-61 | None |
| A0A0S7LXS7 | 47-106 | None |
| A0A7I0ZL03 | 1-64 | None |
| E4YRI1 | 12-77 | None |
| A0A7J7WQ10 | 50-110 | None |
| A0A6P3U590 | 49-128 | None |
| A0A1S3WW43 | 25-103 | None |
| A0A2P4T3E6 | 40-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.