DPCstruct | MC17567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 189 ± 30 aa |
| Standard deviation of domain lengths | 29.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CCD8 | 4-144 | FTVKVFIGVEYECSSGHRFMLAAPDRILKATPGSIVKDTGHKIAESDLPLYYPCPCRGGKLAQLMRLHVVTPKAPVNCTLNPKVQPA… |
| A0A0V1J7R7 | 38-240 | QPNFTRGSNYLLPWNVNVTVDVKKWQDWMNTAANYSKRMSYFSKKPSAIKNGEGLVHVKVFVGFEYECSRGHRFMMQSPDKILKHSG… |
| A0A0V0TAZ7 | 145-382 | None |
| A0A183HG33 | 38-193 | None |
| A0A0P0VRI4 | 31-196 | None |
| A0A7E5VFZ6 | 623-831 | None |
| A0A158QW03 | 675-886 | None |
| A0A1V9YAB2 | 556-720 | None |
| A0A7R8CW53 | 193-347 | None |
| A0A1I7XYP3 | 738-979 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.