DPCstruct | MC17564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00836 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4SM79 | 1-122 | MEVKQINKRASGQAFELILKPPSPVSEAPRTLASPKKKELSLEEIQKKLEAAEERRKSQEAQVLKHLAEKREHEREVLQKALEENNN… |
| A0A4X1STH8 | 85-236 | MKELSVLSLICSCFYPQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKSPSDLSPESPVLSSPPKRKDTSLEELQKRLEAAEERRKT… |
| A0A2I4CQX7 | 12-164 | None |
| A0A2K6GZ35 | 1-127 | None |
| A0A5C6NPJ7 | 47-184 | None |
| A0A672Y8Y0 | 13-143 | None |
| A0A672YBA9 | 7-124 | None |
| A0A6P6KA01 | 96-247 | None |
| S9YUY3 | 4-124 | None |
| T1JD68 | 105-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.