DPCstruct | MC17562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 177 ± 18 aa |
| Standard deviation of domain lengths | 17.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1S2R9 | 46-235 | LTVADCIQIVIMLFIAGTMAVGFASHSHDKKHSQSSLNLSSALSLLERAAQVIVVDGKLTNDRVAWVTCARLISRVEGIKHQLATNT… |
| A0A6P2L8C7 | 4-171 | SAYFAWTAINVNRKDRESKNHMEQAVLALENAYEALTNDGRSITPVESNRLNWLTAARHIESYKVLKQGVTERSHKAMIEDTEEYWR… |
| A0A365ZZG2 | 1-148 | None |
| A0A1V4WFX9 | 18-180 | None |
| A0A3R9QTZ3 | 21-201 | None |
| A0A811GTI8 | 33-219 | None |
| A0A7X7CTF8 | 32-232 | None |
| W9HDJ7 | 24-204 | None |
| A0A1Q5VBP9 | 56-228 | None |
| A0A3A9IKW2 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.