DPCstruct | MC1756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 192 ± 43 aa |
| Standard deviation of domain lengths | 43.02 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4PRD6 | 41-243 | QSNSDNLENQSNANSGDDTNVQESESQSRRNSSRRRTSPRITREQEKFQALLQELSTTCLLYTSRSENVDYEEEDANGSVSQSLARL… |
| A0A2P4NZ50 | 1-113 | MFRKAIKVGQEAILYWCYFIEKYDKMIDNFVVDGVKKKTATSMVYQEIKQLLPDITDVNLRQKILRARKLYKLFNTLGIEKIKQVSY… |
| A0A397SAS7 | 140-325 | None |
| A0A372QV99 | 75-267 | None |
| A0A372QJY5 | 26-223 | None |
| A0A372QBL5 | 5-147 | None |
| A0A372Q9P4 | 166-415 | None |
| A0A372Q4Z4 | 6-159 | None |
| A0A372Q4G2 | 9-179 | None |
| A0A397SXG1 | 161-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.