DPCstruct | MC17556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1FCG3 | 60-253 | QGISPDDVTALVQKGAEQKMGGQSTTLFLSIAVETKRQGLPERPILNRIHQGIAKGVPPDKVLMAAGQVKERLGAAAEVVDKARSQG… |
| A0A1F7MAW2 | 2-217 | SARATERGVPASEALAPVAEAAERGVPAELVAAKVLEGLSKGVPPARIVAVARDLTDRLARADLLLRDAQRAGLAPVTDRNAALGDL… |
| A0A3M2C2G4 | 29-225 | None |
| A0A1V6GR81 | 5-183 | None |
| A0A7X7QRR6 | 8-214 | None |
| A0A7Y5QXV9 | 1-189 | None |
| A0A849DV53 | 16-195 | None |
| A0A2V7LXA4 | 15-199 | None |
| A0A7W1SIK5 | 9-183 | None |
| A0A848X1J6 | 35-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.