DPCstruct | MC17555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5KJ86 | 4-89 | KPYWEGKEYSFVCHKECEYFPCHKTNDPDNFNCLFCYCPLYALGDACGGNFRFTEKGIKDCTNCLLPHVRKNYGYVTGKYSEIMEV |
| A0A2R6T8Z5 | 1-72 | MQNRDCKFFPCHDGIKEEDFNCLFCFCPIYFYENCGGNFELMENGYKDCSNCKIPHTREGYDYIIDKIDKIM |
| A0A1C6L8J1 | 100-184 | None |
| R5VT48 | 3-81 | None |
| A0A1H0NBA6 | 1-63 | None |
| A0A6N7XAW8 | 2-87 | None |
| A0A3C1DF73 | 29-114 | None |
| A0A7V3VV09 | 23-93 | None |
| A0A1Y4CTL2 | 3-94 | None |
| A0A1V5TBK7 | 7-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.