DPCstruct | MC17553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5NY93 | 2-106 | KRIGIIICDRYRHCAGGKCLRSLALREGAFERYEGEEVELAGYTTCGGCPGGNVEYAPQEMKKNGVEAIHLATGLLVGYPPCPYVNE… |
| A0A2R6T4U8 | 33-144 | KKIAIVRCHRTAEVCPGVGCLNAFQDDRVKFKEYEDEETRLVGIFTCGGCPGRRTGRLLDNLEKHDEKPDVVHLGPCMFYDEEQEYV… |
| A0A4Y3G3C6 | 60-168 | None |
| A0A6G7PW59 | 2-114 | None |
| A0A2R4N2D0 | 66-171 | None |
| A0A1Q6R2K5 | 2-117 | None |
| K1Z4K3 | 2-124 | None |
| A0A1V5B1T6 | 1-113 | None |
| A0A0E3S808 | 1-90 | None |
| R6HQ82 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.