DPCstruct | MC17552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 239 ± 35 aa |
| Standard deviation of domain lengths | 35.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10977 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842WF37 | 163-409 | HLISFSSAEKPQITYWERDEEKTAVIEGEASLLFEGRKSCVGFRGRRNRHRCPYHYEGRVQCPFCGSKDISRIYTRHDFRGYEELEE… |
| A0A7T9JXN4 | 23-280 | GLLIEHPLIFGRNVSIEILGNTSCTGYEKNGVWTPCVVGGVPGVKKCEECKKQEGMPIAQYCDGFNTEMFSGEELDSLNCPHYVYFA… |
| A0A1Q5PMN9 | 40-321 | None |
| A0A2W4JRY1 | 45-312 | None |
| A0A847US97 | 26-295 | None |
| A0A387HDY7 | 3-163 | None |
| A0A2T2QYE1 | 7-234 | None |
| A0A1D9MLY9 | 27-258 | None |
| A0A812NHE2 | 19-283 | None |
| A0A6I1YLL5 | 7-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.