DPCstruct | MC17551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 113 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9JWF0 | 26-131 | CSKHTDAPLENNQEEQNDVLETTPETESEEVLTLLAKKYDIDESSITLLQKKKEKTLMRGEYVINGKQKIFLAAQISGEWRLVASDE… |
| A0A420XPM4 | 8-119 | PADVSELRGAPESFKRFVARTVEQLQAEEKCPGAAVGVTVQTLRTDGFAIGGVNACGGYEALWAQVDGTWKEVYGTQDSLDCAVLRR… |
| A0A7K0ZZ67 | 2-169 | None |
| A0A2H0NGW3 | 188-285 | None |
| A0A255H5D0 | 303-421 | None |
| A0A1F6BEE5 | 29-163 | None |
| A0A1F4V3B5 | 58-189 | None |
| A0A0G0XD16 | 35-135 | None |
| A0A2N6A3M1 | 53-193 | None |
| A0A420ZCY0 | 151-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.