DPCstruct | MC17546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 213 ± 47 aa |
| Standard deviation of domain lengths | 47.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 67.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699LP56 | 6-143 | DEEERIEREKNEANRAINEEWDDVQATIDVDRQLAKQIQAQEREQLSIKEISKLLAELIESRRKYFAAKRAEEIKNKPPTKAQQKSL… |
| A0A6L2LLD6 | 51-281 | FFTQQDEKVVEKEVDAAQIQVTTAVTTPTISIDEATLAQPLTELKNAKPKAKAKGIVFHEPEESTTTVLDEEVALKLQAELQVKFDK… |
| A0A6L2P2S2 | 269-439 | None |
| A0A6L2NRC6 | 345-590 | None |
| A0A6L2NMZ5 | 1-183 | None |
| A0A699N5H8 | 64-231 | None |
| A0A6L2N6M0 | 56-223 | None |
| A0A699HYQ1 | 6-171 | None |
| A0A6L2J9U5 | 260-552 | None |
| A0A699MWG5 | 4-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.