DPCstruct | MC17544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 304 |
|---|---|
| Mean domain length (aa) | 173 ± 31 aa |
| Standard deviation of domain lengths | 31.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 92.46 |
| Assigned Pfam label(s) | CL0023- CL0072- CL0021- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816K2I0 | 92-238 | ARELTYAELPTKFVYDSKEKVWNPRKKGFAIGRLAPVSPSSGALYFLRVLLNKIKGPRSYDDIKTVNGIVLPSYEDACYALGLLDDD… |
| A0A6L2L3W1 | 311-471 | ILRMVSANLTEGERFYLRVLLQNIKGPIGFDYLYTVNDVLYTTFHRAALEKGLIKSNIFIHECLRESSTHELPYALRRLFATILIFC… |
| A0A0B7NCB0 | 358-588 | None |
| A0A2G5UNA7 | 134-285 | None |
| A0A0N4WDV6 | 1-156 | None |
| A0A834TT21 | 45-253 | None |
| A0A834SEX3 | 443-575 | None |
| A0A815GTU6 | 46-186 | None |
| A0A4C1UKK0 | 145-360 | None |
| A0A4Y2CCS1 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.