DPCstruct | MC17543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2NKQ4 | 3-154 | SVRKLHSHLKRLSQNNLNGTRIEFGFKRAFATLFGQDIETFTGTMFLNMEQLEKQLDKEDFQEIGSMAAFNVLETHFQMFITSRIYL… |
| A0A6L2L1T0 | 1-199 | MELQDIISSSLKQDIKELQKLQQRKEEIKEKCNEHIQLFKIYVKKQDPKGWYEVGRNERVFRAFFGEEFDSFSEMFVYNMDQLEKQL… |
| A0A6L2J1C7 | 137-325 | None |
| A0A699H049 | 2-161 | None |
| A0A699LN63 | 1-136 | None |
| A0A699LLW6 | 3-146 | None |
| A0A6L2JRW6 | 40-210 | None |
| A0A699HSJ4 | 1-190 | None |
| A0A699HJ19 | 1-192 | None |
| A0A6L2LK81 | 501-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.