DPCstruct | MC17540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 206 ± 41 aa |
| Standard deviation of domain lengths | 41.06 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.67 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0266- PF03040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9MUN7 | 23-235 | SFFFILIYQLLNFLVLRPYAEYLWNHYQTDVFLNSSQEERIFAKLQNFEEEMQFDMLISYTYPLNPQVLHKEMEEKAFELAHMSNNE… |
| A0A1Y0ADU6 | 42-227 | RQSETFLTDIQEKRILEGFIELEELFILDEMIKEKPKTHVQKLPIGIHKEIIQLAKIDNEDHLHIILHFSTNIICLAILSGSFFLGK… |
| A0A7S1J069 | 273-543 | None |
| A0A4Q5Q035 | 56-337 | None |
| A0A140HAM7 | 392-551 | None |
| A0A7S3BAW4 | 48-289 | None |
| A0A7R6ULL0 | 234-399 | None |
| A0A3M1PIB4 | 72-284 | None |
| A0A1R3KJF4 | 26-297 | None |
| A0A6C0RWJ6 | 336-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.