DPCstruct | MC1754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 209 ± 26 aa |
| Standard deviation of domain lengths | 26.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1P5I4 | 4-181 | KYWRAEGRKRGWSDEVIEEKVNQVIEDNKRLKSWFRGGRMLTRYSKSVEGGIIQSPSAKRVRTCSSYLLPLVALGLFVPKLAGPSMA… |
| A0A1D1ZN86 | 18-252 | RHKFSARLVPSRRQKPFVRAAYASGAGEDPYKILELPRSADSTAILRAYRNKLREAKGNENATARIENAHSQIMMSSLSTRLQGKSD… |
| A0A835ISW6 | 114-315 | None |
| A0A6P5H212 | 174-388 | None |
| A0A1U8FHN8 | 9-211 | None |
| A0A803L714 | 23-223 | None |
| A0A0A9ERE4 | 2-172 | None |
| A0A7S3CGA7 | 6-186 | None |
| A0A6T6LWM7 | 2-197 | None |
| A0A7S4QKH4 | 55-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.