DPCstruct | MC17539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 183 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2MBC0 | 5-187 | VVEIKNNNYKKVIKKTRKILNICDKENKKLEIINKGKLITKEDNIELYNIMHAINIKDKSKRYSFIYDTVCDYIDKKYLECNYCDFK… |
| R6DRN9 | 4-172 | GEKDRKNKYKNFKKYINNKDAIIETDPINELEEAFIKAFNEKDIKKRYEFIYDYMCKYLDNNVCILCDFKNDKCIANRLGKSVHKEN… |
| R7F659 | 5-183 | None |
| R6BZ17 | 43-246 | None |
| R5L3G3 | 66-260 | None |
| A0A1Q6K4X7 | 6-172 | None |
| A0A3D0XZH1 | 34-232 | None |
| R7LPY7 | 115-292 | None |
| A0A3D1RIX5 | 89-295 | None |
| R5TN99 | 22-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.