DPCstruct | MC17536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 19.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4KPK6 | 70-206 | SPAVQGALGLLGGVLAALLGGGVWAVLTYATNTELGIVAWGIGWLTGLAVVLFSRGGRGVPFQISAAVCAVLGIAIGKYGSLFLFAN… |
| A0A1G1ZBB0 | 34-200 | VTLQGNKGQSVYLCPECKQKANQAFEDEKKNPNFLLAIIVGAIAAAIGGVVWYFVAIGTGMEIGYISLGLGYIVGFGVYLGAGKKRG… |
| A0A7Y5QE70 | 19-184 | None |
| A0A534ZM09 | 17-166 | None |
| A0A7W0W7C1 | 20-174 | None |
| A0A7W1TJX8 | 69-223 | None |
| A0A542ZPL2 | 47-198 | None |
| A0A5N9A397 | 4-185 | None |
| A0A7C5J691 | 37-181 | None |
| A0A3D9H033 | 76-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.