DPCstruct | MC17535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 175 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 38.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0FS04 | 17-167 | AAATYVPRQAPGTQFITGPCQSDADCASGCCGFNTGKCAGAIVALERDGGCGFGDAQPNDNAARKLRGEAPAAPGTPPPANNGAGGA… |
| L8GBB6 | 22-151 | NSLRGACTSDADCASACCGFNSGKCAGPVVAQERDGGCGFGDAKPNDTAAKALTGGASANNGNAVAGQAAAGQAVAASTSAAAAPGS… |
| A0A6G1GI51 | 1-182 | None |
| A0A6A5XPB6 | 1-209 | None |
| A0A0F2MF34 | 1-188 | None |
| A0A369GSG3 | 105-319 | None |
| A0A175WCV8 | 5-197 | None |
| A0A6S6UXR1 | 21-171 | None |
| A0A219AT12 | 1-204 | None |
| A0A4Y7Q813 | 3-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.