DPCstruct | MC17532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 202 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08313 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371C7S1 | 3-168 | DVERLSVKPWPAKKKKKEKSTPKEKPPVDVEKQCGVPLPNGDLCARSLTCKSHSMGAKRAVQGRSQPYDVLLASYQKKNQVKLATLS… |
| L8G4M2 | 2-187 | PKQKKKKDEPKAKIVKAKVPVDVERQCGVITPNGVPCARSLTCKSHSMGAKRAVPGRSLPYDMLLAAYQKKNQAKQQKAAIDANAPV… |
| I1CR54 | 2-193 | None |
| A0A146H1Z6 | 216-428 | None |
| A0A433Q4N9 | 5-231 | None |
| A0A2K1IVL3 | 47-230 | None |
| A0A420HU31 | 1-168 | None |
| A0A0G4KV69 | 292-524 | None |
| A0A177TLB2 | 188-336 | None |
| A0A094FTB3 | 243-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.