DPCstruct | MC17531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0S660 | 193-304 | MDRYRPRLELFLKELRVHEDEQIRQGSLKESQRLSERMALSIKDGLFWFCLAARNSFMFDEIYWTFLDEQYFGPLSSLGDRLSRLTQ… |
| L8G4H2 | 5-119 | RAYEPRLRTFLAVFHEREDAFMQEGRLDENHRLSLPMRESWESGDFWVVYAASKSFAFYAVFWKYLDTRFSGPAAELDGDEWERRTG… |
| A0A1V6XXK5 | 2-112 | None |
| A0A1J9QXR8 | 1-121 | None |
| A0A0A2IE50 | 139-261 | None |
| A0A3A2ZFC2 | 59-172 | None |
| A0A1V6V1C1 | 32-149 | None |
| V5G9Q6 | 212-329 | None |
| A0A7H8R0J8 | 428-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.